Hemolysincabind

Author: jbgx

August undefined, 2024

http://pfam-legacy.xfam.org/family/HemolysinCabind WebKEGG Orthology (KO) [BR:nsh00001] 09100 Metabolism 09101 Carbohydrate metabolism 00562 Inositol phosphate metabolism GXM_06899 Enzymes [BR:nsh01000] 3. Hydrolases

myRT - omics.informatics.indiana.edu

Web1 dec. 2012 · HemolysinCabind (PF00353) The SSA_1099 of S. sanguinis is the only streptococcal protein that contains HemolysinCabind domain. The protein has ten HemolysinCabind repeats, and the predicted product is the repeats-in-toxin (RTX) … http://supfam.mbu.iisc.ernet.in/CGI/display_pfam.cgi?name=HemolysinCabind& gw2 lion\\u0027s memory

CDD Conserved Protein Domain Family: HemolysinCabind

WebViewers. Legend. Settings Webcl15317 (PSSM ID: 417693): Conserved Protein Domain Family HemolysinCabind, WebPlease note: when we start each new Pfam data release, we take a copy of the UniProt sequence database. This snapshot of UniProt forms the basis of the overview that you … gw2 lion\u0027s arch sharkmaw caverns vista

Protein domain repetition is enriched in Streptococcal cell …

KEGG T05266: COO91_00480

Web18 jul. 2024 · Fig. 1. Schematic representation of fibrillar adhesins domain architecture and comparison to a pilus polymer: Three well studied fibrillar adhesins from S. aureus are … WebThe zinc binding site/active site of EEB69635 is indicated by blue lines, with the HemolysinCabind domains in red and the matrixin domain (pfam00413) in green. (C) … boy names starting with d 4 lettersWebMonzonetal.BMCGenomics (2024) 22:550 Page5of14 Collagen-hug binding mechanism, two domains build a trench in which the ligand docks and is finally locked. By comparing … boy names starting with don

"WebDUF1542 is the highest repeated domain in a single protein, followed by Rib, CW_binding_1, G5 and HemolysinCabind. 3D structures of 24 repeat-containing … " - Hemolysincabind

Hemolysincabind

WebmyRT report for GCA_903917955.1_freshwater_MAG_---_Ki3-D4_bin-316 Download annotations/find similar RTs Seq: CAIXCO010000048.1 uncultured Chlorobiaceae … WebKEGG Orthology (KO) [BR:ddd00001] 09160 Human Diseases 09175 Drug resistance: antimicrobial 01503 Cationic antimicrobial peptide (CAMP) resistance Dda3937_04583 (prtB)

Did you know?

WebDUF1542 is the highest repeated domain in a single protein, followed by Rib, CW_binding_1, G5 and HemolysinCabind. 3D structures of 24 repeat-containing …

WebHemolysinCabind: Pfam: 1424: 1459: P55127: HemolysinCabind Pfam: 1233: 1268: Visualization. Protein 3D Structure . Top. PDB Accession Method Resolution Chain … http://pfam-legacy.xfam.org/protein/K9TCW9_9CYAN

WebIn addition, several blocks of tional file 1, section B). In the Corby strain, we distinguish tandem repeats identified as HemolysinCabind domains two different types of repeats, … Web7-Aug-2024. Structure. ? Aligned Rows: Download Cn3D. PubMed References. pfam00353 is classified as a model that may span more than one domain. pfam00353 is the only …

WebUniProtKB. x; UniProtKB. Protein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects.

WebUniProtKB. x; UniProtKB. Protein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. boy names starting with eliWebgenome browser: aa seq: 6481 aa aa seq db search mnkslpvvdalngfliknhpngqssiakngakvvpgeqlillsgeailhhlgvgwtalev ghpfkldgispllksvitqadienlieqavangidpipllnmleataageetplgsggdt gw2 living world rewardsWebKEGG Orthology (KO) [BR:nfl00001] 09100 Metabolism 09101 Carbohydrate metabolism 00562 Inositol phosphate metabolism COO91_00480 Enzymes [BR:nfl01000] 3. Hydrolases gw2 lion\u0027s memoryWeb1 feb. 2005 · The presence of a HemolysinCabind domain, which is typically associated with T1SS toxins, agrees with pLbAR_38 being adjacent to four genes encoding an RTX … boy names starting with enWebHemolysinCabind: Pfam: 117: 151: Visualization. Protein 3D Structure . Top. PDB Accession Method Resolution Chain Structure Review; Sorry. There is no result for this … gw2 literary thieveryWebOverview 1 RT 1: 75140-81727 bp Neighborhood of RT #1 [75140, 81909] PRK09040 OmpA_C-like HemolysinCabind HemolysinCabind HemolysinCabind … gw2 living world season 3 flashpointWebgenome browser: aa seq: 6481 aa aa seq db search mnkslpvvdalngfliknhpngqssiakngakvvpgeqlillsgeailhhlgvgwtalev … boy names starting with du